PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015889409.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family GRAS
Protein Properties Length: 750aa    MW: 81768.1 Da    PI: 5.5697
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015889409.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS331.81.3e-1013927482373
            GRAS   2 velLlecAeavssgdlelaqalLarlsel.aspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     +++L ++Ae +++g+  laq +Larl+++ +sp g+p+qR+a+yf+eAL++ l+    ++ + l+ s+ s    + ++ a+k fse+sP+l+f++
  XP_015889409.1 392 IDQLSKAAELIETGNPVLAQGILARLNHQlSSPIGKPFQRAAFYFKEALQTLLHM---NTTNPLALSPFS---LIFKIGAYKSFSEISPVLQFAN 480
                     789************************998************************9...555555555555...********************** PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledle 190
                     +t+NqaIleaveg +rvH+iDfd+++G+QWp+++q+La R++g++sl+iT+++s++ +++ e   t+e+L++fA+e+++ fe++++ + ++ +  
  XP_015889409.1 481 FTCNQAILEAVEGFNRVHVIDFDVGYGGQWPSFMQELALRNGGSASLKITAFVSSSMQDEFEFGFTQENLKHFASEINLAFEIEII-SLEVLNSA 574
                     ******************************************************9999***************************6.44455555 PP

            GRAS 191 leeL..rvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseeri 283
                      + L  +v++ Ea+aVnl +  ++ +  ++sl+     vL++vk+lsPk+vv  ++ +++ + sF +++++al++ys l++sl+a    + ++ +
  XP_015889409.1 575 SWPLpfNVSESEAIAVNLPIGSFSSY--PLSLPL----VLRFVKQLSPKIVVSLDRGCERMDVSFSHQIIHALNTYSGLLESLDAV-NVNLDALQ 662
                     6666448888**********999888..777777....*********************************************665.3566999* PP

            GRAS 284 kvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                     k+Er ll++ i++vv+ ++++     e+   Wr  + ++GF+p+++s+++++qa++l+++++++g+++e ++ slvl+W++++L+s+SaW
  XP_015889409.1 663 KIERYLLQPGIEKVVMGRHRS----PERTPPWRTVFLTSGFSPLTFSNFTESQADCLVQRTPVRGFHIERKQSSLVLCWQRKELISASAW 748
                     ****************99998....9999************************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098544.658365729IPR005202Transcription factor GRAS
PfamPF035144.4E-99392748IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0048768Biological Processroot hair cell tip growth
GO:0051301Biological Processcell division
Sequence ? help Back to Top
Protein Sequence    Length: 750 aa     Download sequence    Send to blast
MKAMPLPFEE FQGKGVLDFS PASDSLLASQ QQQQQQPQKW KTTEQENCYV GSEPTSVLDT  60
RRSPSPPTSS STLSSSLGSG GGGGNGGGSG STDTTGVAAV AVSGNPSSRA APLEEEKCGL  120
GMEDWESVLS ESPGQDQSIL RLIMADVEDP SLGLNKLLQS GSGSQDMEFN TGFGVVDQGY  180
GFEPNSGNLV NNNNIIDPSL QATSCSDFPF NPTPNNVHSN NARLSPLGSV SNPSPSPIFS  240
ASANNPLPVS LAPVVFHQQQ HPQLVEGGDE KPQIFNPQVV INQHQAQFAQ NPALFMPLTY  300
AQLQEHHLLS PPPAKRLNSG NTGANYQLQR VQFPNSGQEL FVRGQQQQLQ LLPQHLHHQQ  360
RPTMAATKQK MVGPAAAGGD ELMNHQLQQA MIDQLSKAAE LIETGNPVLA QGILARLNHQ  420
LSSPIGKPFQ RAAFYFKEAL QTLLHMNTTN PLALSPFSLI FKIGAYKSFS EISPVLQFAN  480
FTCNQAILEA VEGFNRVHVI DFDVGYGGQW PSFMQELALR NGGSASLKIT AFVSSSMQDE  540
FEFGFTQENL KHFASEINLA FEIEIISLEV LNSASWPLPF NVSESEAIAV NLPIGSFSSY  600
PLSLPLVLRF VKQLSPKIVV SLDRGCERMD VSFSHQIIHA LNTYSGLLES LDAVNVNLDA  660
LQKIERYLLQ PGIEKVVMGR HRSPERTPPW RTVFLTSGFS PLTFSNFTES QADCLVQRTP  720
VRGFHIERKQ SSLVLCWQRK ELISASAWSC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-3240674818374GRAS family transcription factor containing p
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17888SGGGGGNGGGS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819241e-41LN681924.1 Cucumis melo genomic scaffold, anchoredscaffold00047.
GenBankLN7132651e-41LN713265.1 Cucumis melo genomic chromosome, chr_11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015889409.10.0PREDICTED: scarecrow-like protein 6
SwissprotO813161e-157SCL6_ARATH; Scarecrow-like protein 6
TrEMBLA0A061DW610.0A0A061DW61_THECC; GRAS family transcription factor
STRINGVIT_15s0048g00270.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF31833170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-158GRAS family protein